Lineage for d1dkgb2 (1dkg B:38-138)

  1. Root: SCOP 1.57
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (20 superfamilies)
  4. 91281Superfamily h.1.9: Coiled-coil domain of nucleotide exchange factor GrpE [58014] (1 family) (S)
  5. 91282Family h.1.9.1: Coiled-coil domain of nucleotide exchange factor GrpE [58015] (1 protein)
  6. 91283Protein Coiled-coil domain of nucleotide exchange factor GrpE [58016] (1 species)
  7. 91284Species Escherichia coli [TaxId:562] [58017] (1 PDB entry)
  8. 91286Domain d1dkgb2: 1dkg B:38-138 [45627]
    Other proteins in same PDB: d1dkga1, d1dkgb1, d1dkgd1, d1dkgd2

Details for d1dkgb2

PDB Entry: 1dkg (more details), 2.8 Å

PDB Description: crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak

SCOP Domain Sequences for d1dkgb2:

Sequence, based on SEQRES records: (download)

>d1dkgb2 h.1.9.1 (B:38-138) Coiled-coil domain of nucleotide exchange factor GrpE {Escherichia coli}
dprdekvanleaqlaeaqtrerdgilrvkaemenlrrrteldiekahkfalekfinellp
vidsldralevadkanpdmsamvedieltlksmldvvrkfg

Sequence, based on observed residues (ATOM records): (download)

>d1dkgb2 h.1.9.1 (B:38-138) Coiled-coil domain of nucleotide exchange factor GrpE {Escherichia coli}
dprdekvanleaqlaeaqtrerdgilrvkaemenlrrrteldiekahkfalekfinellp
vidsldralevmsamvedieltlksmldvvrkfg

SCOP Domain Coordinates for d1dkgb2:

Click to download the PDB-style file with coordinates for d1dkgb2.
(The format of our PDB-style files is described here.)

Timeline for d1dkgb2: