Lineage for d1fzef2 (1fze F:92-141)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. Superfamily h.1.8: Fibrinogen coiled-coil region [58010] (1 family) (S)
  5. Family h.1.8.1: Fibrinogen coiled-coil region [58011] (1 protein)
  6. Protein Fibrinogen coiled-coil region [58012] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58013] (6 PDB entries)
  8. 42197Domain d1fzef2: 1fze F:92-141 [45619]
    Other proteins in same PDB: d1fzeb1, d1fzec1, d1fzee1, d1fzef1

Details for d1fzef2

PDB Entry: 1fze (more details), 3 Å

PDB Description: crystal structure of fragment double-d from human fibrin

SCOP Domain Sequences for d1fzef2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzef2 h.1.8.1 (F:92-141) Fibrinogen coiled-coil region {Human (Homo sapiens)}
eimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

SCOP Domain Coordinates for d1fzef2:

Click to download the PDB-style file with coordinates for d1fzef2.
(The format of our PDB-style files is described here.)

Timeline for d1fzef2: