Lineage for d1fzeb2 (1fze B:151-199)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644538Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 2644539Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 2644604Protein Fibrinogen beta chain [88892] (4 species)
  7. 2644613Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
    Uniprot P02675
  8. 2644634Domain d1fzeb2: 1fze B:151-199 [45615]
    Other proteins in same PDB: d1fzea_, d1fzeb1, d1fzec1, d1fzec2, d1fzed_, d1fzee1, d1fzef1, d1fzef2
    coiled-coil region only
    complexed with ca, nag

Details for d1fzeb2

PDB Entry: 1fze (more details), 3 Å

PDB Description: crystal structure of fragment double-d from human fibrin
PDB Compounds: (B:) fibrinogen

SCOPe Domain Sequences for d1fzeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzeb2 h.1.8.1 (B:151-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOPe Domain Coordinates for d1fzeb2:

Click to download the PDB-style file with coordinates for d1fzeb2.
(The format of our PDB-style files is described here.)

Timeline for d1fzeb2:

2644634
d1fzeb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1fzeb1