SCOP 1.75: Domain d1fzbe2: 1fzb E:148-199

Lineage for d1fzbe2 (1fzb E:148-199)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen beta chain [88892] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
   Uniprot P02675

8. Domain d1fzbe2: 1fzb E:148-199 [45612]
   Other proteins in same PDB: d1fzba_, d1fzbb1, d1fzbc1, d1fzbc2, d1fzbd_, d1fzbe1, d1fzbf1, d1fzbf2
   coiled-coil region only
   complexed with ca, nag

Details for d1fzbe2

PDB Entry: 1fzb, 2.9 Å

PDB Description: crystal structure of crosslinked fragment d

PDB Compounds: (E:) fibrinogen

SCOP Domain Sequences for d1fzbe2:

Sequence; same for both SEQRES and ATOM records:

>d1fzbe2 h.1.8.1 (E:148-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
khqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

Timeline for d1fzbe2:

• d1fzbe2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzbe2 appears in SCOP 1.73
  
• d1fzbe2 appears in SCOPe 2.01
  
• d1fzbe2 appears in the current release, SCOPe 2.08