SCOP 1.73: Domain d1fzbc2: 1fzb C:88-141

Lineage for d1fzbc2 (1fzb C:88-141)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (15 PDB entries)

8. Domain d1fzbc2: 1fzb C:88-141 [45610]
   Other proteins in same PDB: d1fzba_, d1fzbb1, d1fzbb2, d1fzbc1, d1fzbd_, d1fzbe1, d1fzbe2, d1fzbf1

Details for d1fzbc2

PDB Entry: 1fzb, 2.9 Å

PDB Description: crystal structure of crosslinked fragment d

PDB Compounds: (C:) fibrinogen

SCOP Domain Sequences for d1fzbc2:

Sequence; same for both SEQRES and ATOM records:

>d1fzbc2 h.1.8.1 (C:88-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1fzbc2:

• d1fzbc2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzbc2 appears in SCOP 1.71
  
• d1fzbc2 appears in SCOP 1.75
  
• d1fzbc2 appears in the current release, SCOPe 2.08