Lineage for d1fzge2 (1fzg E:164-199)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 752733Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 752734Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 752798Protein Fibrinogen beta chain [88892] (4 species)
  7. 752807Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
  8. 752821Domain d1fzge2: 1fzg E:164-199 [45606]
    Other proteins in same PDB: d1fzga_, d1fzgb1, d1fzgc1, d1fzgc2, d1fzgd_, d1fzge1, d1fzgf1, d1fzgf2
    complexed with ca, nag

Details for d1fzge2

PDB Entry: 1fzg (more details), 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide
PDB Compounds: (E:) fibrinogen

SCOP Domain Sequences for d1fzge2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzge2 h.1.8.1 (E:164-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
nlrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOP Domain Coordinates for d1fzge2:

Click to download the PDB-style file with coordinates for d1fzge2.
(The format of our PDB-style files is described here.)

Timeline for d1fzge2: