![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (33 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
![]() | Protein Fibrinogen beta chain [88892] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries) |
![]() | Domain d1fzge2: 1fzg E:164-199 [45606] Other proteins in same PDB: d1fzga_, d1fzgb1, d1fzgc1, d1fzgc2, d1fzgd_, d1fzge1, d1fzgf1, d1fzgf2 complexed with ca, nag |
PDB Entry: 1fzg (more details), 2.5 Å
SCOP Domain Sequences for d1fzge2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzge2 h.1.8.1 (E:164-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]} nlrvlrsilenlrskiqklesdvsaqmeycrtpctv
Timeline for d1fzge2: