Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (26 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen beta chain [88892] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88895] (10 PDB entries) |
Domain d1fzgb2: 1fzg B:157-199 [45603] Other proteins in same PDB: d1fzga_, d1fzgb1, d1fzgc1, d1fzgc2, d1fzgd_, d1fzge1, d1fzgf1, d1fzgf2 |
PDB Entry: 1fzg (more details), 2.5 Å
SCOP Domain Sequences for d1fzgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzgb2 h.1.8.1 (B:157-199) Fibrinogen beta chain {Human (Homo sapiens)} vnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv
Timeline for d1fzgb2: