SCOP 1.75: Domain d1fzfe2: 1fzf E:164-199

Lineage for d1fzfe2 (1fzf E:164-199)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen beta chain [88892] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
   Uniprot P02675

8. Domain d1fzfe2: 1fzf E:164-199 [45600]
   Other proteins in same PDB: d1fzfa_, d1fzfb1, d1fzfc1, d1fzfc2, d1fzfd_, d1fzfe1, d1fzff1, d1fzff2
   coiled-coil region only
   complexed with ca, nag

Details for d1fzfe2

PDB Entry: 1fzf, 2.7 Å

PDB Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide

PDB Compounds: (E:) fibrinogen

SCOP Domain Sequences for d1fzfe2:

Sequence; same for both SEQRES and ATOM records:

>d1fzfe2 h.1.8.1 (E:164-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
nlrvlrsilenlrskiqklesdvsaqmeycrtpctv

Timeline for d1fzfe2:

• d1fzfe2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzfe2 appears in SCOP 1.73
  
• d1fzfe2 appears in SCOPe 2.01
  
• d1fzfe2 appears in the current release, SCOPe 2.08