Lineage for d1fzfe2 (1fzf E:164-199)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431024Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 431436Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 431437Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 431481Protein Fibrinogen beta chain [88892] (4 species)
  7. 431490Species Human (Homo sapiens) [TaxId:9606] [88895] (13 PDB entries)
  8. 431496Domain d1fzfe2: 1fzf E:164-199 [45600]
    Other proteins in same PDB: d1fzfa_, d1fzfb1, d1fzfc1, d1fzfc2, d1fzfd_, d1fzfe1, d1fzff1, d1fzff2
    coiled-coil region only
    complexed with ca, nag

Details for d1fzfe2

PDB Entry: 1fzf (more details), 2.7 Å

PDB Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzfe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzfe2 h.1.8.1 (E:164-199) Fibrinogen beta chain {Human (Homo sapiens)}
nlrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOP Domain Coordinates for d1fzfe2:

Click to download the PDB-style file with coordinates for d1fzfe2.
(The format of our PDB-style files is described here.)

Timeline for d1fzfe2: