Lineage for d1fzfd_ (1fzf D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3039950Protein Fibrinogen alpha chain [88887] (4 species)
  7. 3039959Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
    Uniprot P02671 150-209
  8. 3039972Domain d1fzfd_: 1fzf D: [45599]
    Other proteins in same PDB: d1fzfb1, d1fzfb2, d1fzfc1, d1fzfc2, d1fzfe1, d1fzfe2, d1fzff1, d1fzff2
    coiled-coil region only
    complexed with ca, nag

Details for d1fzfd_

PDB Entry: 1fzf (more details), 2.7 Å

PDB Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide
PDB Compounds: (D:) fibrinogen

SCOPe Domain Sequences for d1fzfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzfd_ h.1.8.1 (D:) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
llqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqv

SCOPe Domain Coordinates for d1fzfd_:

Click to download the PDB-style file with coordinates for d1fzfd_.
(The format of our PDB-style files is described here.)

Timeline for d1fzfd_: