Lineage for d1fzfc2 (1fzf C:102-141)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 345233Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 345234Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 345309Protein Fibrinogen gamma chain [88898] (4 species)
  7. 345318Species Human (Homo sapiens) [TaxId:9606] [88900] (10 PDB entries)
  8. 345323Domain d1fzfc2: 1fzf C:102-141 [45598]
    Other proteins in same PDB: d1fzfa_, d1fzfb1, d1fzfb2, d1fzfc1, d1fzfd_, d1fzfe1, d1fzfe2, d1fzff1

Details for d1fzfc2

PDB Entry: 1fzf (more details), 2.7 Å

PDB Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzfc2 h.1.8.1 (C:102-141) Fibrinogen gamma chain {Human (Homo sapiens)}
thdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

SCOP Domain Coordinates for d1fzfc2:

Click to download the PDB-style file with coordinates for d1fzfc2.
(The format of our PDB-style files is described here.)

Timeline for d1fzfc2:

345323
d1fzfc2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1fzfc1