SCOPe 2.05: Domain d1fzcf2: 1fzc F:97-141

Lineage for d1fzcf2 (1fzc F:97-141)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
   Uniprot P02679

8. Domain d1fzcf2: 1fzc F:97-141 [45595]
   Other proteins in same PDB: d1fzca_, d1fzcb1, d1fzcb2, d1fzcc1, d1fzcd_, d1fzce1, d1fzce2, d1fzcf1
   coiled-coil region only
   complexed with ca, man, nag

Details for d1fzcf2

PDB Entry: 1fzc, 2.3 Å

PDB Description: crystal structure of fragment double-d from human fibrin with two different bound ligands

PDB Compounds: (F:) fibrin

SCOPe Domain Sequences for d1fzcf2:

Sequence; same for both SEQRES and ATOM records:

>d1fzcf2 h.1.8.1 (F:97-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1fzcf2:

• d1fzcf2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzcf2 appears in SCOPe 2.04
  
• d1fzcf2 appears in SCOPe 2.06
  
• d1fzcf2 appears in the current release, SCOPe 2.08