SCOPe 2.08: Domain d1vdfd_: 1vdf D:

Lineage for d1vdfd_ (1vdf D:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family)

5. Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein)

6. Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species)
   pentameric coiled-coil

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [58009] (7 PDB entries)

8. Domain d1vdfd_: 1vdf D: [45583]
   complexed with cl

Details for d1vdfd_

PDB Entry: 1vdf, 2.05 Å

PDB Description: assembly domain of cartilage oligomeric matrix protein

PDB Compounds: (D:) cartilage oligomeric matrix protein

SCOPe Domain Sequences for d1vdfd_:

Sequence; same for both SEQRES and ATOM records:

>d1vdfd_ h.1.7.1 (D:) Assembly domain of cartilage oligomeric matrix protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg

Timeline for d1vdfd_:

• d1vdfd_ first appeared (with stable ids) in SCOP 1.55
  
• d1vdfd_ appears in SCOPe 2.07