Lineage for d1vdfb_ (1vdf B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1968849Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family) (S)
  5. 1968850Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein)
  6. 1968851Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species)
    pentameric coiled-coil
  7. 1968852Species Norway rat (Rattus norvegicus) [TaxId:10116] [58009] (7 PDB entries)
  8. 1968869Domain d1vdfb_: 1vdf B: [45581]
    complexed with cl

Details for d1vdfb_

PDB Entry: 1vdf (more details), 2.05 Å

PDB Description: assembly domain of cartilage oligomeric matrix protein
PDB Compounds: (B:) cartilage oligomeric matrix protein

SCOPe Domain Sequences for d1vdfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdfb_ h.1.7.1 (B:) Assembly domain of cartilage oligomeric matrix protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg

SCOPe Domain Coordinates for d1vdfb_:

Click to download the PDB-style file with coordinates for d1vdfb_.
(The format of our PDB-style files is described here.)

Timeline for d1vdfb_: