Lineage for d1vdfa_ (1vdf A:)

  1. Root: SCOPe 2.08
  2. Class h: Coiled coil proteins [57942] (7 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family) (S)
  5. Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein)
  6. Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species)
    pentameric coiled-coil
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [58009] (7 PDB entries)
  8. Domain d1vdfa_: 1vdf A: [45580]
    complexed with cl

Details for d1vdfa_

PDB Entry: 1vdf (more details), 2.05 Å

PDB Description: assembly domain of cartilage oligomeric matrix protein
PDB Compounds: (A:) cartilage oligomeric matrix protein

SCOPe Domain Sequences for d1vdfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdfa_ h.1.7.1 (A:) Assembly domain of cartilage oligomeric matrix protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg

SCOPe Domain Coordinates for d1vdfa_ are not available.

Timeline for d1vdfa_:

Domains from other chains:
(mouse over for more information)
d1vdfb_, d1vdfc_, d1vdfd_, d1vdfe_