SCOPe 2.06: Domain d2cpsa_: 2cps A:

Lineage for d2cpsa_ (2cps A:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family)

5. Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)

6. Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)

7. Species Bacteriophage M13 [TaxId:10870] [57995] (2 PDB entries)

8. Domain d2cpsa_: 2cps A: [45569]

Details for d2cpsa_

PDB Entry: 2cps

PDB Description: solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in sodium dodecyl sulphate micelles, 25 lowest energy structures

PDB Compounds: (A:) m13 major coat protein

SCOPe Domain Sequences for d2cpsa_:

Sequence; same for both SEQRES and ATOM records:

>d2cpsa_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage M13 [TaxId: 10870]}
aegddpakaafnslqasateyigyawamvvvivgatigiklfkkftskas

Timeline for d2cpsa_:

• d2cpsa_ first appeared (with stable ids) in SCOP 1.55, called d2cps__
  
• d2cpsa_ appears in SCOPe 2.05
  
• d2cpsa_ appears in SCOPe 2.07
  
• d2cpsa_ appears in the current release, SCOPe 2.08