Lineage for d2ifoa_ (2ifo A:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266033Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. 2266034Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. 2266035Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)
  7. 2266073Species Bacteriophage xf [TaxId:356629] [57994] (1 PDB entry)
  8. 2266074Domain d2ifoa_: 2ifo A: [45567]

Details for d2ifoa_

PDB Entry: 2ifo (more details)

PDB Description: model-building studies of inovirus: genetic variations on a geometric theme
PDB Compounds: (A:) inovirus

SCOPe Domain Sequences for d2ifoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifoa_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage xf [TaxId: 356629]}
sggggvdvgdvvsaiqgaagpiaaiggavltvmvgikvykwvrram

SCOPe Domain Coordinates for d2ifoa_:

Click to download the PDB-style file with coordinates for d2ifoa_.
(The format of our PDB-style files is described here.)

Timeline for d2ifoa_: