Lineage for d1ifla_ (1ifl A:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266033Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. 2266034Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. 2266035Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)
  7. 2266046Species Bacteriophage ike [TaxId:10867] [57993] (1 PDB entry)
  8. 2266047Domain d1ifla_: 1ifl A: [45566]
    mutant

Details for d1ifla_

PDB Entry: 1ifl (more details), 5 Å

PDB Description: molecular models and structural comparisons of native and mutant class i filamentous bacteriophages ff (fd, f1, m13), if1 and ike
PDB Compounds: (A:) inovirus

SCOPe Domain Sequences for d1ifla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifla_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage ike [TaxId: 10867]}
aepnaatnyateamdslktqaidlisqtwpvvttvvvaglvirlfkkfsskav

SCOPe Domain Coordinates for d1ifla_:

Click to download the PDB-style file with coordinates for d1ifla_.
(The format of our PDB-style files is described here.)

Timeline for d1ifla_: