Lineage for d1ifl__ (1ifl -)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. Protein Inovirus (filamentous phage) major coat protein [57989] (7 species)
  7. Species Bacteriophage ike [TaxId:10867] [57993] (1 PDB entry)
  8. Domain d1ifl__: 1ifl - [45566]

Details for d1ifl__

PDB Entry: 1ifl (more details), 5 Å

PDB Description: molecular models and structural comparisons of native and mutant class i filamentous bacteriophages ff (fd, f1, m13), if1 and ike

SCOP Domain Sequences for d1ifl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifl__ h.1.4.1 (-) Inovirus (filamentous phage) major coat protein {Bacteriophage ike}
aepnaatnyateamdslktqaidlisqtwpvvttvvvaglvirlfkkfsskav

SCOP Domain Coordinates for d1ifl__ are not available.

Timeline for d1ifl__: