| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) ![]() |
| Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein) |
| Protein Inovirus (filamentous phage) major coat protein [57989] (8 species) |
| Species Bacteriophage if1 [TaxId:10868] [57992] (1 PDB entry) |
| Domain d1ifka_: 1ifk A: [45565] mutant |
PDB Entry: 1ifk (more details), 5 Å
SCOPe Domain Sequences for d1ifka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ifka_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage if1 [TaxId: 10868]}
addatsqakaafdsltaqatemsgyawalvvlvvgatvgiklfkkfvsras
Timeline for d1ifka_: