Lineage for d1ifka_ (1ifk A:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266033Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. 2266034Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. 2266035Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)
  7. 2266044Species Bacteriophage if1 [TaxId:10868] [57992] (1 PDB entry)
  8. 2266045Domain d1ifka_: 1ifk A: [45565]
    mutant

Details for d1ifka_

PDB Entry: 1ifk (more details), 5 Å

PDB Description: molecular models and structural comparisons of native and mutant class i filamentous bacteriophages ff (fd, f1, m13), if1 and ike
PDB Compounds: (A:) inovirus

SCOPe Domain Sequences for d1ifka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifka_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage if1 [TaxId: 10868]}
addatsqakaafdsltaqatemsgyawalvvlvvgatvgiklfkkfvsras

SCOPe Domain Coordinates for d1ifka_:

Click to download the PDB-style file with coordinates for d1ifka_.
(The format of our PDB-style files is described here.)

Timeline for d1ifka_: