| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) ![]() |
| Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein) |
| Protein Inovirus (filamentous phage) major coat protein [57989] (8 species) |
| Species Bacteriophage pf1 [TaxId:10871] [57991] (12 PDB entries) Uniprot P03621 |
| Domain d2ifna_: 2ifn A: [45563] |
PDB Entry: 2ifn (more details), 4 Å
SCOPe Domain Sequences for d2ifna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ifna_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage pf1 [TaxId: 10871]}
gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka
Timeline for d2ifna_: