Lineage for d1pfia_ (1pfi A:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266033Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. 2266034Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. 2266035Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)
  7. 2266051Species Bacteriophage pf1 [TaxId:10871] [57991] (12 PDB entries)
    Uniprot P03621
  8. 2266056Domain d1pfia_: 1pfi A: [45558]
    protein/DNA complex

Details for d1pfia_

PDB Entry: 1pfi (more details), 3 Å

PDB Description: pf1 virus structure: helical coat protein and dna with paraxial phosphates
PDB Compounds: (A:) major coat protein of pf1 virus

SCOPe Domain Sequences for d1pfia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfia_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage pf1 [TaxId: 10871]}
gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka

SCOPe Domain Coordinates for d1pfia_:

Click to download the PDB-style file with coordinates for d1pfia_.
(The format of our PDB-style files is described here.)

Timeline for d1pfia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pfib_