SCOPe 2.08: Domain d1pfia_: 1pfi A:

Lineage for d1pfia_ (1pfi A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family)

5. Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)

6. Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)

7. Species Bacteriophage pf1 [TaxId:10871] [57991] (12 PDB entries)
   Uniprot P03621

8. Domain d1pfia_: 1pfi A: [45558]
   protein/DNA complex

Details for d1pfia_

PDB Entry: 1pfi, 3 Å

PDB Description: pf1 virus structure: helical coat protein and dna with paraxial phosphates

PDB Compounds: (A:) major coat protein of pf1 virus

SCOPe Domain Sequences for d1pfia_:

Sequence; same for both SEQRES and ATOM records:

>d1pfia_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage pf1 [TaxId: 10871]}
gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka

Timeline for d1pfia_:

• d1pfia_ first appeared (with stable ids) in SCOP 1.55
  
• d1pfia_ appears in SCOPe 2.07