SCOPe 2.05: Domain d1ql2a_: 1ql2 A:

Lineage for d1ql2a_ (1ql2 A:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family)

5. Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)

6. Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)

7. Species Bacteriophage pf1 [TaxId:10871] [57991] (12 PDB entries)
   Uniprot P03621

8. Domain d1ql2a_: 1ql2 A: [45554]

Details for d1ql2a_

PDB Entry: 1ql2, 3.1 Å

PDB Description: inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly

PDB Compounds: (A:) pf1 bacteriophage coat protein b

SCOPe Domain Sequences for d1ql2a_:

Sequence; same for both SEQRES and ATOM records:

>d1ql2a_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage pf1 [TaxId: 10871]}
gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka

Timeline for d1ql2a_:

• d1ql2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ql2a_ appears in SCOPe 2.04
  
• d1ql2a_ appears in SCOPe 2.06
  
• d1ql2a_ appears in the current release, SCOPe 2.08