Lineage for d1ci6b_ (1ci6 B:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1466121Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1466343Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 1466344Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 1466375Protein C/ebp beta [57985] (2 species)
  7. 1466397Species Mouse (Mus musculus) [TaxId:10090] [57986] (1 PDB entry)
  8. 1466398Domain d1ci6b_: 1ci6 B: [45549]
    Other proteins in same PDB: d1ci6a_
    heterodimer with Atf4
    complexed with bme, fe

Details for d1ci6b_

PDB Entry: 1ci6 (more details), 2.6 Å

PDB Description: transcription factor atf4-c/ebp beta bzip heterodimer
PDB Compounds: (B:) transcription factor c/ebp beta

SCOPe Domain Sequences for d1ci6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci6b_ h.1.3.1 (B:) C/ebp beta {Mouse (Mus musculus) [TaxId: 10090]}
srdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnlfkql

SCOPe Domain Coordinates for d1ci6b_:

Click to download the PDB-style file with coordinates for d1ci6b_.
(The format of our PDB-style files is described here.)

Timeline for d1ci6b_:

1466398
d1ci6b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1ci6a_