Lineage for d1ci6b_ (1ci6 B:)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 752378Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 752379Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 752408Protein C/ebp beta [57985] (2 species)
  7. 752428Species Mouse (Mus musculus) [TaxId:10090] [57986] (1 PDB entry)
  8. 752429Domain d1ci6b_: 1ci6 B: [45549]
    Other proteins in same PDB: d1ci6a_
    heterodimer with Atf4

Details for d1ci6b_

PDB Entry: 1ci6 (more details), 2.6 Å

PDB Description: transcription factor atf4-c/ebp beta bzip heterodimer
PDB Compounds: (B:) transcription factor c/ebp beta

SCOP Domain Sequences for d1ci6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci6b_ h.1.3.1 (B:) C/ebp beta {Mouse (Mus musculus) [TaxId: 10090]}
srdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnlfkql

SCOP Domain Coordinates for d1ci6b_:

Click to download the PDB-style file with coordinates for d1ci6b_.
(The format of our PDB-style files is described here.)

Timeline for d1ci6b_: