![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.3: Leucine zipper domain [57959] (1 family) ![]() |
![]() | Family h.1.3.1: Leucine zipper domain [57960] (16 proteins) |
![]() | Protein C-jun [57975] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57976] (7 PDB entries) Uniprot P05412 253-314 |
![]() | Domain d1junb_: 1jun B: [45541] homodimer |
PDB Entry: 1jun (more details)
SCOP Domain Sequences for d1junb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1junb_ h.1.3.1 (B:) C-jun {Human (Homo sapiens) [TaxId: 9606]} cggriarleekvktlkaqnselastanmlreqvaqlkqkvmny
Timeline for d1junb_: