Lineage for d1junb_ (1jun B:)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 625747Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 625902Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 625903Family h.1.3.1: Leucine zipper domain [57960] (15 proteins)
  6. 625912Protein C-jun [57975] (1 species)
  7. 625913Species Human (Homo sapiens) [TaxId:9606] [57976] (5 PDB entries)
  8. 625921Domain d1junb_: 1jun B: [45541]
    homodimer

Details for d1junb_

PDB Entry: 1jun (more details)

PDB Description: nmr study of c-jun homodimer

SCOP Domain Sequences for d1junb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1junb_ h.1.3.1 (B:) C-jun {Human (Homo sapiens)}
cggriarleekvktlkaqnselastanmlreqvaqlkqkvmny

SCOP Domain Coordinates for d1junb_:

Click to download the PDB-style file with coordinates for d1junb_.
(The format of our PDB-style files is described here.)

Timeline for d1junb_:

625921
d1junb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1juna_