Lineage for d1juna_ (1jun A:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 894928Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 894929Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 894939Protein C-jun [57975] (1 species)
  7. 894940Species Human (Homo sapiens) [TaxId:9606] [57976] (7 PDB entries)
    Uniprot P05412 253-314
  8. 894950Domain d1juna_: 1jun A: [45540]
    homodimer

Details for d1juna_

PDB Entry: 1jun (more details)

PDB Description: nmr study of c-jun homodimer
PDB Compounds: (A:) c-jun homodimer

SCOP Domain Sequences for d1juna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1juna_ h.1.3.1 (A:) C-jun {Human (Homo sapiens) [TaxId: 9606]}
cggriarleekvktlkaqnselastanmlreqvaqlkqkvmny

SCOP Domain Coordinates for d1juna_:

Click to download the PDB-style file with coordinates for d1juna_.
(The format of our PDB-style files is described here.)

Timeline for d1juna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1junb_