Lineage for d1juna_ (1jun A:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
  6. Protein C-jun [57975] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [57976] (3 PDB entries)
  8. Domain d1juna_: 1jun A: [45540]

Details for d1juna_

PDB Entry: 1jun (more details)

PDB Description: nmr study of c-jun homodimer

SCOP Domain Sequences for d1juna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1juna_ h.1.3.1 (A:) C-jun {Human (Homo sapiens)}
cggriarleekvktlkaqnselastanmlreqvaqlkqkvmny

SCOP Domain Coordinates for d1juna_ are not available.

Timeline for d1juna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1junb_