SCOP 1.73: Domain d1gd2f_: 1gd2 F:

Lineage for d1gd2f_ (1gd2 F:)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)

5. Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)

6. Protein PAP1 [57971] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [57972] (1 PDB entry)

8. Domain d1gd2f_: 1gd2 F: [45529]

Details for d1gd2f_

PDB Entry: 1gd2, 2 Å

PDB Description: crystal structure of bzip transcription factor pap1 bound to dna

PDB Compounds: (F:) transcription factor pap1

SCOP Domain Sequences for d1gd2f_:

Sequence; same for both SEQRES and ATOM records:

>d1gd2f_ h.1.3.1 (F:) PAP1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
epsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvrqleeel
rilk

Timeline for d1gd2f_:

• d1gd2f_ first appeared (with stable ids) in SCOP 1.55
  
• d1gd2f_ appears in SCOP 1.71
  
• d1gd2f_ appears in SCOP 1.75
  
• d1gd2f_ appears in the current release, SCOPe 2.08