Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (29 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) |
Family h.1.3.1: Leucine zipper domain [57960] (15 proteins) |
Protein PAP1 [57971] (1 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [57972] (1 PDB entry) |
Domain d1gd2e_: 1gd2 E: [45528] |
PDB Entry: 1gd2 (more details), 2 Å
SCOP Domain Sequences for d1gd2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gd2e_ h.1.3.1 (E:) PAP1 {Fission yeast (Schizosaccharomyces pombe)} dqepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvrqlee elril
Timeline for d1gd2e_: