Lineage for d1gd2e_ (1gd2 E:)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 625747Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 625902Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 625903Family h.1.3.1: Leucine zipper domain [57960] (15 proteins)
  6. 626110Protein PAP1 [57971] (1 species)
  7. 626111Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [57972] (1 PDB entry)
  8. 626112Domain d1gd2e_: 1gd2 E: [45528]

Details for d1gd2e_

PDB Entry: 1gd2 (more details), 2 Å

PDB Description: crystal structure of bzip transcription factor pap1 bound to dna

SCOP Domain Sequences for d1gd2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd2e_ h.1.3.1 (E:) PAP1 {Fission yeast (Schizosaccharomyces pombe)}
dqepsskrkaqnraaqrafrkrkedhlkaletqvvtlkelhssttlendqlrqkvrqlee
elril

SCOP Domain Coordinates for d1gd2e_:

Click to download the PDB-style file with coordinates for d1gd2e_.
(The format of our PDB-style files is described here.)

Timeline for d1gd2e_: