SCOP 1.57: Domain d1zta__: 1zta -

Lineage for d1zta__ (1zta -)

1. Root: SCOP 1.57
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.1: Parallel coiled-coil [57943] (20 superfamilies)
4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)
5. Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
6. Protein GCN4 [57961] (1 species)
7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (20 PDB entries)
8. Domain d1zta__: 1zta - [45509]

Details for d1zta__

PDB Entry: 1zta

PDB Description: the solution structure of a leucine-zipper motif peptide

SCOP Domain Sequences for d1zta__:

Sequence; same for both SEQRES and ATOM records:

>d1zta__ h.1.3.1 (-) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
lqrmkqledkveellsknyhlenevarlkklvger

SCOP Domain Coordinates for d1zta__ are not available.

Timeline for d1zta__:

• d1zta__ first appeared (with stable ids) in SCOP 1.55
  
• d1zta__ appears in SCOP 1.59
  
• d1zta__ appears in the current release, SCOPe 2.08, called d1ztaa_