SCOP 1.57: Domain d1ysad_: 1ysa D:

Lineage for d1ysad_ (1ysa D:)

1. Root: SCOP 1.57
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.1: Parallel coiled-coil [57943] (20 superfamilies)
4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)
5. Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
6. Protein GCN4 [57961] (1 species)
7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (20 PDB entries)
8. Domain d1ysad_: 1ysa D: [45508]

Details for d1ysad_

PDB Entry: 1ysa, 2.9 Å

PDB Description: the gcn4 basic region leucine zipper binds dna as a dimer of uninterrupted alpha helices: crystal structure of the protein-dna complex

SCOP Domain Sequences for d1ysad_:

Sequence, based on SEQRES records:

>d1ysad_ h.1.3.1 (D:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
ssdpaalkrarnteaarrsrarklqrmkqledkveellsknyhlenevarlkklvge

Sequence, based on observed residues (ATOM records):

>d1ysad_ h.1.3.1 (D:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
mkdpaalkrarnteaarrsrarklqrmkqledkveellsknyhlenevarlkklvge

SCOP Domain Coordinates for d1ysad_ are not available.

Timeline for d1ysad_:

• d1ysad_ first appeared (with stable ids) in SCOP 1.55
  
• d1ysad_ appears in SCOP 1.59
  
• d1ysad_ appears in the current release, SCOPe 2.08