SCOP 1.65: Domain d1ysac_: 1ysa C:

Lineage for d1ysac_ (1ysa C:)

1. Root: SCOP 1.65

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)

5. Family h.1.3.1: Leucine zipper domain [57960] (14 proteins)

6. Protein GCN4 [57961] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries)

8. Domain d1ysac_: 1ysa C: [45507]

Details for d1ysac_

PDB Entry: 1ysa, 2.9 Å

PDB Description: the gcn4 basic region leucine zipper binds dna as a dimer of uninterrupted alpha helices: crystal structure of the protein-dna complex

SCOP Domain Sequences for d1ysac_:

Sequence, based on SEQRES records:

>d1ysac_ h.1.3.1 (C:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
sdpaalkrarnteaarrsrarklqrmkqledkveellsknyhlenevarlkklvger

Sequence, based on observed residues (ATOM records):

>d1ysac_ h.1.3.1 (C:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
kdpaalkrarnteaarrsrarklqrmkqledkveellsknyhlenevarlkklvger

Timeline for d1ysac_:

• d1ysac_ first appeared (with stable ids) in SCOP 1.55
  
• d1ysac_ appears in SCOP 1.63
  
• d1ysac_ appears in SCOP 1.67
  
• d1ysac_ appears in the current release, SCOPe 2.08