Lineage for d1zijc_ (1zij C:)

  1. Root: SCOP 1.57
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (20 superfamilies)
  4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
  6. Protein GCN4 [57961] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (20 PDB entries)
  8. Domain d1zijc_: 1zij C: [45496]

Details for d1zijc_

PDB Entry: 1zij (more details), 2 Å

PDB Description: gcn4-leucine zipper core mutant asn16aba in the trimeric state

SCOP Domain Sequences for d1zijc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zijc_ h.1.3.1 (C:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellsknyhlenevarlkklvger

SCOP Domain Coordinates for d1zijc_ are not available.

Timeline for d1zijc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zija_, d1zijb_