Lineage for d1zijb_ (1zij B:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431024Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 431178Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 431179Family h.1.3.1: Leucine zipper domain [57960] (14 proteins)
  6. 431233Protein GCN4 [57961] (1 species)
  7. 431234Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (27 PDB entries)
  8. 431291Domain d1zijb_: 1zij B: [45495]

Details for d1zijb_

PDB Entry: 1zij (more details), 2 Å

PDB Description: gcn4-leucine zipper core mutant asn16aba in the trimeric state

SCOP Domain Sequences for d1zijb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zijb_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellsknyhlenevarlkklvger

SCOP Domain Coordinates for d1zijb_:

Click to download the PDB-style file with coordinates for d1zijb_.
(The format of our PDB-style files is described here.)

Timeline for d1zijb_: