Lineage for d1zija_ (1zij A:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 344989Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 344990Family h.1.3.1: Leucine zipper domain [57960] (14 proteins)
  6. 345042Protein GCN4 [57961] (1 species)
  7. 345043Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries)
  8. 345090Domain d1zija_: 1zij A: [45494]

Details for d1zija_

PDB Entry: 1zij (more details), 2 Å

PDB Description: gcn4-leucine zipper core mutant asn16aba in the trimeric state

SCOP Domain Sequences for d1zija_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zija_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellsknyhlenevarlkklvger

SCOP Domain Coordinates for d1zija_:

Click to download the PDB-style file with coordinates for d1zija_.
(The format of our PDB-style files is described here.)

Timeline for d1zija_: