Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) |
Family h.1.3.1: Leucine zipper domain [57960] (16 proteins) |
Protein GCN4 [57961] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (62 PDB entries) Uniprot P03069 249-279 Uniprot P03069 249-281 Uniprot P03069 249-279 ! Uniprot P03069 249-281 |
Domain d1zikb_: 1zik B: [45482] |
PDB Entry: 1zik (more details), 1.8 Å
SCOP Domain Sequences for d1zikb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zikb_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} rmkqledkveellskkyhlenevarlkklv
Timeline for d1zikb_: