Lineage for d2ztaa_ (2zta A:)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 625747Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 625902Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 625903Family h.1.3.1: Leucine zipper domain [57960] (15 proteins)
  6. 625961Protein GCN4 [57961] (1 species)
  7. 625962Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (50 PDB entries)
  8. 625970Domain d2ztaa_: 2zta A: [45474]

Details for d2ztaa_

PDB Entry: 2zta (more details), 1.8 Å

PDB Description: x-ray structure of the gcn4 leucine zipper, a two-stranded, parallel coiled coil

SCOP Domain Sequences for d2ztaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ztaa_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellsknyhlenevarlkklvg

SCOP Domain Coordinates for d2ztaa_:

Click to download the PDB-style file with coordinates for d2ztaa_.
(The format of our PDB-style files is described here.)

Timeline for d2ztaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ztab_