SCOPe 2.05: Domain d1fllb2: 1fll B:300-349

Lineage for d1fllb2 (1fll B:300-349)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.2: Trimerization domain of TRAF [57953] (1 family)

5. Family h.1.2.1: Trimerization domain of TRAF [57954] (2 proteins)

6. Protein TRAF3 [57957] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57958] (5 PDB entries)
   Uniprot Q13114 377-568

8. Domain d1fllb2: 1fll B:300-349 [45472]
   Other proteins in same PDB: d1flla1, d1fllb1
   complexed with a fragment from B-cell surface antigen CD40

Details for d1fllb2

PDB Entry: 1fll, 3.5 Å

PDB Description: molecular basis for cd40 signaling mediated by traf3

PDB Compounds: (B:) tnf receptor associated factor 3

SCOPe Domain Sequences for d1fllb2:

Sequence; same for both SEQRES and ATOM records:

>d1fllb2 h.1.2.1 (B:300-349) TRAF3 {Human (Homo sapiens) [TaxId: 9606]}
lesvdksagqvarntgllesqlsrhdqmlsvhdirladmdlrfqvletas

Timeline for d1fllb2:

• d1fllb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fllb2 appears in SCOPe 2.04
  
• d1fllb2 appears in SCOPe 2.06
  
• d1fllb2 appears in the current release, SCOPe 2.08