Lineage for d1f81a_ (1f81 A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41879Fold g.53: TAZ domain [57932] (1 superfamily)
  4. 41880Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
  5. 41881Family g.53.1.1: TAZ domain [57934] (1 protein)
  6. 41882Protein CREB-binding transcriptional adaptor protein CBP [57935] (1 species)
  7. 41883Species Mouse (Mus musculus) [TaxId:10090] [57936] (1 PDB entry)
  8. 41884Domain d1f81a_: 1f81 A: [45383]

Details for d1f81a_

PDB Entry: 1f81 (more details)

PDB Description: solution structure of the taz2 domain of the transcriptional adaptor protein cbp

SCOP Domain Sequences for d1f81a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f81a_ g.53.1.1 (A:) CREB-binding transcriptional adaptor protein CBP {Mouse (Mus musculus)}
spqesrrlsiqrciqslvhacqcrnancslpscqkmkrvvqhtkgckrktnggcpvckql
ialccyhakhcqenkcpvpfclnikhk

SCOP Domain Coordinates for d1f81a_:

Click to download the PDB-style file with coordinates for d1f81a_.
(The format of our PDB-style files is described here.)

Timeline for d1f81a_: