Lineage for d1f3hb_ (1f3h B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642738Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2642739Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2642740Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2642756Protein Anti-apoptotic protein survivin [57930] (2 species)
    contains a long alpha-helix after the common fold
  7. 2642757Species Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries)
  8. 2642769Domain d1f3hb_: 1f3h B: [45382]
    complexed with so4, zn

Details for d1f3hb_

PDB Entry: 1f3h (more details), 2.58 Å

PDB Description: x-ray crystal structure of the human anti-apoptotic protein survivin
PDB Compounds: (B:) survivin

SCOPe Domain Sequences for d1f3hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3hb_ g.52.1.1 (B:) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]}
lppawqpflkdhristfknwpflegcactpermaeagfihcptenepdmaqcffcfkele
gwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaketnnkkkefe
etakkvrraieqlaa

SCOPe Domain Coordinates for d1f3hb_:

Click to download the PDB-style file with coordinates for d1f3hb_.
(The format of our PDB-style files is described here.)

Timeline for d1f3hb_: