SCOPe 2.06: Domain d1f3hb_: 1f3h B:

Lineage for d1f3hb_ (1f3h B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein Anti-apoptotic protein survivin [57930] (2 species)
   contains a long alpha-helix after the common fold

7. Species Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries)

8. Domain d1f3hb_: 1f3h B: [45382]
   complexed with so4, zn

Details for d1f3hb_

PDB Entry: 1f3h, 2.58 Å

PDB Description: x-ray crystal structure of the human anti-apoptotic protein survivin

PDB Compounds: (B:) survivin

SCOPe Domain Sequences for d1f3hb_:

Sequence; same for both SEQRES and ATOM records:

>d1f3hb_ g.52.1.1 (B:) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]}
lppawqpflkdhristfknwpflegcactpermaeagfihcptenepdmaqcffcfkele
gwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaketnnkkkefe
etakkvrraieqlaa

Timeline for d1f3hb_:

• d1f3hb_ first appeared (with stable ids) in SCOP 1.55
  
• d1f3hb_ appears in SCOPe 2.05
  
• d1f3hb_ appears in SCOPe 2.07
  
• d1f3hb_ appears in the current release, SCOPe 2.08