Lineage for d1f3ha_ (1f3h A:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) 
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (3 proteins) 
Protein Anti-apoptotic protein survivin [57930] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57931] (2 PDB entries) 
Domain d1f3ha_: 1f3h A: [45381]
Details for d1f3ha_
PDB Entry: 1f3h (more details), 2.58 Å
PDB Description: x-ray crystal structure of the human anti-apoptotic protein survivin
SCOP Domain Sequences for d1f3ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3ha_ g.52.1.1 (A:) Anti-apoptotic protein survivin {Human (Homo sapiens)}
tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdmaqcffcfkel
egwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaketnnkkkef
eetakkvrraieqlaa
SCOP Domain Coordinates for d1f3ha_:
Click to download the PDB-style file with coordinates for d1f3ha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f3ha_:
- d1f3ha_ appears in SCOP 1.57
- d1f3ha_ appears in the current release, SCOPe 2.08
View in 3D
