Lineage for d1qbha_ (1qbh A:)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) 
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (3 proteins) 
Protein 2MIHB/C-IAP-1 [57926] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57927] (1 PDB entry) 
Domain d1qbha_: 1qbh A: [45374]
Details for d1qbha_
PDB Entry: 1qbh (more details)
PDB Description: solution structure of a baculoviral inhibitor of apoptosis (iap) repeat
SCOP Domain Sequences for d1qbha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qbha_ g.52.1.1 (A:) 2MIHB/C-IAP-1 {Human (Homo sapiens)}
gshmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp
wvehakwfprceflirmkgqefvdeiqgryphlleqllsts
SCOP Domain Coordinates for d1qbha_:
Click to download the PDB-style file with coordinates for d1qbha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qbha_:
- d1qbha_ first appeared (with stable ids) in SCOP 1.55
- d1qbha_ appears in SCOP 1.59
- d1qbha_ appears in the current release, SCOPe 2.08, called d1qbha1
View in 3D