Lineage for d1anv_2 (1anv 266-385)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625307Fold g.51: Zn-binding domains of ADDBP [57916] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 625308Superfamily g.51.1: Zn-binding domains of ADDBP [57917] (1 family) (S)
    duplication: contains two Zn-binding domains of similar fold
  5. 625309Family g.51.1.1: Zn-binding domains of ADDBP [57918] (2 proteins)
  6. 625310Protein First Zn-domain of early E2A DNA-binding protein, ADDBP [57919] (1 species)
    Single-stranded DNA-binding protein
  7. 625311Species Human adenovirus type 5 [TaxId:28285] [57920] (4 PDB entries)
  8. 625315Domain d1anv_2: 1anv 266-385 [45365]
    Other proteins in same PDB: d1anv_1, d1anv_3
    complexed with ium, zn

Details for d1anv_2

PDB Entry: 1anv (more details), 2.7 Å

PDB Description: adenovirus 5 dbp/uranyl fluoride soak

SCOP Domain Sequences for d1anv_2:

Sequence, based on SEQRES records: (download)

>d1anv_2 g.51.1.1 (266-385) First Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5}
tgcalwlhrcaeiegelkclhgsiminkehviemdvtsengqralkeqsskakivknrwg
rnvvqisntdarccvhdaacpanqfsgkscgmffsegakaqvafkqikafmqalypnaqt

Sequence, based on observed residues (ATOM records): (download)

>d1anv_2 g.51.1.1 (266-385) First Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5}
tgcalwlhrcaeiegelkclhgsiminkehvienvvqisntdarccvhdaacpanqfsgk
scgmffsegakaqvafkqikafmqalypnaqt

SCOP Domain Coordinates for d1anv_2:

Click to download the PDB-style file with coordinates for d1anv_2.
(The format of our PDB-style files is described here.)

Timeline for d1anv_2: