SCOPe 2.08: Domain d1adub2: 1adu B:266-385

Lineage for d1adub2 (1adu B:266-385)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.51: Zn-binding domains of ADDBP [57916] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.51.1: Zn-binding domains of ADDBP [57917] (1 family)
   duplication: contains two Zn-binding domains of similar fold
   automatically mapped to Pfam PF03728

5. Family g.51.1.1: Zn-binding domains of ADDBP [57918] (3 proteins)

6. Protein First Zn-domain of early E2A DNA-binding protein, ADDBP [57919] (1 species)
   Single-stranded DNA-binding protein

7. Species Human adenovirus type 5 [TaxId:28285] [57920] (4 PDB entries)

8. Domain d1adub2: 1adu B:266-385 [45364]
   Other proteins in same PDB: d1adua1, d1adua3, d1adub1, d1adub3
   complexed with zn
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1adub2

PDB Entry: 1adu, 3 Å

PDB Description: early e2a dna-binding protein

PDB Compounds: (B:) adenovirus single-stranded DNA-binding protein

SCOPe Domain Sequences for d1adub2:

Sequence, based on SEQRES records:

>d1adub2 g.51.1.1 (B:266-385) First Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
tgcalwlhrcaeiegelkclhgsiminkehviemdvtsengqralkeqsskakivknrwg
rnvvqisntdarccvhdaacpanqfsgkscgmffsegakaqvafkqikafmqalypnaqt

Sequence, based on observed residues (ATOM records):

>d1adub2 g.51.1.1 (B:266-385) First Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
tgcalwlhrcaeiegelkclhgsimindarccvhdafsgkscgmffsegakaqvafkqik
afmqalypnaqt

Timeline for d1adub2:

• d1adub2 first appeared (with stable ids) in SCOP 1.55
  
• d1adub2 appears in SCOPe 2.07