| Class g: Small proteins [56992] (100 folds) |
| Fold g.51: Zn-binding domains of ADDBP [57916] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.51.1: Zn-binding domains of ADDBP [57917] (1 family) ![]() duplication: contains two Zn-binding domains of similar fold automatically mapped to Pfam PF03728 |
| Family g.51.1.1: Zn-binding domains of ADDBP [57918] (3 proteins) |
| Protein First Zn-domain of early E2A DNA-binding protein, ADDBP [57919] (1 species) Single-stranded DNA-binding protein |
| Species Human adenovirus type 5 [TaxId:28285] [57920] (4 PDB entries) |
| Domain d1adub2: 1adu B:266-385 [45364] Other proteins in same PDB: d1adua1, d1adua3, d1adub1, d1adub3 complexed with zn fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1adu (more details), 3 Å
SCOPe Domain Sequences for d1adub2:
Sequence, based on SEQRES records: (download)
>d1adub2 g.51.1.1 (B:266-385) First Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
tgcalwlhrcaeiegelkclhgsiminkehviemdvtsengqralkeqsskakivknrwg
rnvvqisntdarccvhdaacpanqfsgkscgmffsegakaqvafkqikafmqalypnaqt
>d1adub2 g.51.1.1 (B:266-385) First Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
tgcalwlhrcaeiegelkclhgsimindarccvhdafsgkscgmffsegakaqvafkqik
afmqalypnaqt
Timeline for d1adub2: