Lineage for d1fp0a1 (1fp0 A:19-88)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625240Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 625241Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) (S)
  5. 625264Family g.50.1.2: PHD domain [57911] (12 proteins)
  6. 625276Protein Nuclear corepressor KAP-1 (TIF-1beta) [57914] (1 species)
  7. 625277Species Human (Homo sapiens) [TaxId:9606] [57915] (1 PDB entry)
  8. 625278Domain d1fp0a1: 1fp0 A:19-88 [45361]
    complexed with zn

Details for d1fp0a1

PDB Entry: 1fp0 (more details)

PDB Description: solution structure of the phd domain from the kap-1 corepressor

SCOP Domain Sequences for d1fp0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens)}
gtlddsaticrvcqkpgdlvmcnqcefcfhldchlpalqdvpgeewscslchvlpdlkee
dvdlqackln

SCOP Domain Coordinates for d1fp0a1:

Click to download the PDB-style file with coordinates for d1fp0a1.
(The format of our PDB-style files is described here.)

Timeline for d1fp0a1: