Class g: Small proteins [56992] (79 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) |
Family g.50.1.2: PHD domain [57911] (12 proteins) |
Protein Nuclear corepressor KAP-1 (TIF-1beta) [57914] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57915] (1 PDB entry) |
Domain d1fp0a1: 1fp0 A:19-88 [45361] complexed with zn |
PDB Entry: 1fp0 (more details)
SCOP Domain Sequences for d1fp0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens)} gtlddsaticrvcqkpgdlvmcnqcefcfhldchlpalqdvpgeewscslchvlpdlkee dvdlqackln
Timeline for d1fp0a1: