Lineage for d1fp0a1 (1fp0 A:19-79)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588901Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588902Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2588925Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 2588943Protein Nuclear corepressor KAP-1 (TIF-1beta) [57914] (1 species)
  7. 2588944Species Human (Homo sapiens) [TaxId:9606] [57915] (1 PDB entry)
  8. 2588945Domain d1fp0a1: 1fp0 A:19-79 [45361]
    Other proteins in same PDB: d1fp0a2, d1fp0a3
    complexed with zn

Details for d1fp0a1

PDB Entry: 1fp0 (more details)

PDB Description: solution structure of the phd domain from the kap-1 corepressor
PDB Compounds: (A:) kap-1 corepressor

SCOPe Domain Sequences for d1fp0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fp0a1 g.50.1.2 (A:19-79) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]}
gtlddsaticrvcqkpgdlvmcnqcefcfhldchlpalqdvpgeewscslchvlpdlkee
d

SCOPe Domain Coordinates for d1fp0a1:

Click to download the PDB-style file with coordinates for d1fp0a1.
(The format of our PDB-style files is described here.)

Timeline for d1fp0a1: